PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG535600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 747aa    MW: 80874.3 Da    PI: 6.6083
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG535600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox469e-15105157456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           ++++  q e+Le +F  + +p++++r++LA+ +gL   qVk+WFqN+R+  k
  Pavir.5NG535600.1.p 105 LQRLNGRQAEILEGFFSVCAHPDENQRRQLAAMTGLGLLQVKFWFQNKRTNVK 157
                          5678889******************************************9776 PP

2START77.82.7e-252634783204
                          HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                          a  aa el+ + + ++p+W  ++    + +n++ + q+f+  +          + ea ras+vv  ++   ve l+d++  +   ++   
  Pavir.5NG535600.1.p 263 AMNAAHELFILSDPSSPLWLAVPggsfQVLNRMAYAQTFPG-QMsvgamamgLTAEATRASAVVMLDAKSIVEFLMDSG-SFGAFFPglm 350
                          5567777777788899***********************55.555**********************************.8888888877 PP

                          .....EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEE CS
                START  78 .....kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliep 156
                               + ++++  ++      ga ql + el+++splvp R+ +f+Ry+++l+ g  v+vdvS+d  ++         +++ pSg li+p
  Pavir.5NG535600.1.p 351 sgvatSTKVYNWPQNSeagydGAMQLLTVELVFPSPLVPaRKCTFLRYCKRLELGAMVVVDVSLDDGAN---------CQKMPSGVLIQP 431
                          8777788888877777999*********************************************99988.........779********* PP

                          ECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
                START 157 ksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                               +kvt +ehv ++g+  h+l++  + sgl +ga++wv  + rq 
  Pavir.5NG535600.1.p 432 IRHTSCKVTAIEHVRVDGSGTHELFQACL-SGLLFGARRWVMSMARQS 478
                          *************************9887.79*********9888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-1589157IPR009057Homeodomain-like
SuperFamilySSF466894.6E-1595158IPR009057Homeodomain-like
PROSITE profilePS5007114.15599159IPR001356Homeobox domain
SMARTSM003895.8E-13101163IPR001356Homeobox domain
CDDcd000865.10E-12102158No hitNo description
PfamPF000462.0E-12103157IPR001356Homeobox domain
PROSITE patternPS000270134157IPR017970Homeobox, conserved site
PROSITE profilePS5084819.115252483IPR002913START domain
CDDcd088754.50E-66257479No hitNo description
SMARTSM002346.2E-4261480IPR002913START domain
PfamPF018523.2E-17263478IPR002913START domain
SuperFamilySSF559612.61E-14318476No hitNo description
SuperFamilySSF559613.98E-7520715No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MGIDELSGGH PCFMGSTSGI GDSSLMGPPS SIAVGFSSKR NEISEKNSSS YFGEPQGNNG  60
HGEIPGDGAP RINEDNLSIL ASNNNANGRS VADGQDGPEP KKRSLQRLNG RQAEILEGFF  120
SVCAHPDENQ RRQLAAMTGL GLLQVKFWFQ NKRTNVKHLS GKEENYRLKV ENEMLREENY  180
IFKQAQNNPL CPRCTNDPGY LELIKELEQV KAYNRMLQQQ LQMYIDNEAR LTMISPTGVF  240
HHGSSSGNAF AMQDDVQALT EVAMNAAHEL FILSDPSSPL WLAVPGGSFQ VLNRMAYAQT  300
FPGQMSVGAM AMGLTAEATR ASAVVMLDAK SIVEFLMDSG SFGAFFPGLM SGVATSTKVY  360
NWPQNSEAGY DGAMQLLTVE LVFPSPLVPA RKCTFLRYCK RLELGAMVVV DVSLDDGANC  420
QKMPSGVLIQ PIRHTSCKVT AIEHVRVDGS GTHELFQACL SGLLFGARRW VMSMARQSAR  480
LRDVFHVTNC TLDVTSRGRK AIMKLADSLL ANYSGSIAGL PADAWIVQCG DGTEQDVKIA  540
YRRNDDSSNT AIVCTSATFL LPLPMRRVFD LLKSNLLRVK WDVLVHGGCV KEVVRVANGV  600
GSEDTVSILH VKHGSGANKE TMLILQNSCY DASGSFMVYS SLDKHVMEMI TSPGGEEAMS  660
NIALFPAGFS LVPLADPADA GSPIGEAGGT LMTAGFQILM KLARGTGLYP RSVSSAIQIM  720
TENIATIKDT LMNSHPVFYK TIQTPN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660716.10.0PREDICTED: homeobox-leucine zipper protein TF1
SwissprotQ5ZAY00.0TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLK3XF210.0K3XF21_SETIT; Uncharacterized protein
STRINGSi000488m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.41e-111homeodomain GLABROUS 2